author_facet Warnholtz, Ascan
Mollnau, Hanke
Heitzer, Thomas
Kontush, Anatol
Möller-Bertram, Tobias
Lavall, Dirk
Giaid, Adel
Beisiegel, Ulrike
Marklund, Stefan L
Walter, Ulrich
Meinertz, Thomas
Munzel, Thomas
Warnholtz, Ascan
Mollnau, Hanke
Heitzer, Thomas
Kontush, Anatol
Möller-Bertram, Tobias
Lavall, Dirk
Giaid, Adel
Beisiegel, Ulrike
Marklund, Stefan L
Walter, Ulrich
Meinertz, Thomas
Munzel, Thomas
author Warnholtz, Ascan
Mollnau, Hanke
Heitzer, Thomas
Kontush, Anatol
Möller-Bertram, Tobias
Lavall, Dirk
Giaid, Adel
Beisiegel, Ulrike
Marklund, Stefan L
Walter, Ulrich
Meinertz, Thomas
Munzel, Thomas
spellingShingle Warnholtz, Ascan
Mollnau, Hanke
Heitzer, Thomas
Kontush, Anatol
Möller-Bertram, Tobias
Lavall, Dirk
Giaid, Adel
Beisiegel, Ulrike
Marklund, Stefan L
Walter, Ulrich
Meinertz, Thomas
Munzel, Thomas
Journal of the American College of Cardiology
Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
Cardiology and Cardiovascular Medicine
author_sort warnholtz, ascan
spelling Warnholtz, Ascan Mollnau, Hanke Heitzer, Thomas Kontush, Anatol Möller-Bertram, Tobias Lavall, Dirk Giaid, Adel Beisiegel, Ulrike Marklund, Stefan L Walter, Ulrich Meinertz, Thomas Munzel, Thomas 0735-1097 Elsevier BV Cardiology and Cardiovascular Medicine http://dx.doi.org/10.1016/s0735-1097(02)02133-2 Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits Journal of the American College of Cardiology
doi_str_mv 10.1016/s0735-1097(02)02133-2
facet_avail Online
Free
finc_class_facet Medizin
format ElectronicArticle
fullrecord blob:ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAxNi9zMDczNS0xMDk3KDAyKTAyMTMzLTI
id ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAxNi9zMDczNS0xMDk3KDAyKTAyMTMzLTI
institution DE-D275
DE-Bn3
DE-Brt1
DE-Zwi2
DE-D161
DE-Gla1
DE-Zi4
DE-15
DE-Pl11
DE-Rs1
DE-105
DE-14
DE-Ch1
DE-L229
imprint Elsevier BV, 2002
imprint_str_mv Elsevier BV, 2002
issn 0735-1097
issn_str_mv 0735-1097
language English
mega_collection Elsevier BV (CrossRef)
match_str warnholtz2002adverseeffectsofnitroglycerintreatmentonendothelialfunctionvascularnitrotyrosinelevelsandcgmpdependentproteinkinaseactivityinhyperlipidemicwatanaberabbits
publishDateSort 2002
publisher Elsevier BV
recordtype ai
record_format ai
series Journal of the American College of Cardiology
source_id 49
title Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_unstemmed Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_full Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_fullStr Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_full_unstemmed Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_short Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_sort adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cgmp-dependent protein kinase activity in hyperlipidemic watanabe rabbits
topic Cardiology and Cardiovascular Medicine
url http://dx.doi.org/10.1016/s0735-1097(02)02133-2
publishDate 2002
physical 1356-1363
description
container_issue 7
container_start_page 1356
container_title Journal of the American College of Cardiology
container_volume 40
format_de105 Article, E-Article
format_de14 Article, E-Article
format_de15 Article, E-Article
format_de520 Article, E-Article
format_de540 Article, E-Article
format_dech1 Article, E-Article
format_ded117 Article, E-Article
format_degla1 E-Article
format_del152 Buch
format_del189 Article, E-Article
format_dezi4 Article
format_dezwi2 Article, E-Article
format_finc Article, E-Article
format_nrw Article, E-Article
_version_ 1792336969887383567
geogr_code not assigned
last_indexed 2024-03-01T15:08:28.679Z
geogr_code_person not assigned
openURL url_ver=Z39.88-2004&ctx_ver=Z39.88-2004&ctx_enc=info%3Aofi%2Fenc%3AUTF-8&rfr_id=info%3Asid%2Fvufind.svn.sourceforge.net%3Agenerator&rft.title=Adverse+effects+of+nitroglycerin+treatment+on+endothelial+function%2C+vascular+nitrotyrosine+levels+and+cGMP-dependent+protein+kinase+activity+in+hyperlipidemic+Watanabe+rabbits&rft.date=2002-10-01&genre=article&issn=0735-1097&volume=40&issue=7&spage=1356&epage=1363&pages=1356-1363&jtitle=Journal+of+the+American+College+of+Cardiology&atitle=Adverse+effects+of+nitroglycerin+treatment+on+endothelial+function%2C+vascular+nitrotyrosine+levels+and+cGMP-dependent+protein+kinase+activity+in+hyperlipidemic+Watanabe+rabbits&aulast=Munzel&aufirst=Thomas&rft_id=info%3Adoi%2F10.1016%2Fs0735-1097%2802%2902133-2&rft.language%5B0%5D=eng
SOLR
_version_ 1792336969887383567
author Warnholtz, Ascan, Mollnau, Hanke, Heitzer, Thomas, Kontush, Anatol, Möller-Bertram, Tobias, Lavall, Dirk, Giaid, Adel, Beisiegel, Ulrike, Marklund, Stefan L, Walter, Ulrich, Meinertz, Thomas, Munzel, Thomas
author_facet Warnholtz, Ascan, Mollnau, Hanke, Heitzer, Thomas, Kontush, Anatol, Möller-Bertram, Tobias, Lavall, Dirk, Giaid, Adel, Beisiegel, Ulrike, Marklund, Stefan L, Walter, Ulrich, Meinertz, Thomas, Munzel, Thomas, Warnholtz, Ascan, Mollnau, Hanke, Heitzer, Thomas, Kontush, Anatol, Möller-Bertram, Tobias, Lavall, Dirk, Giaid, Adel, Beisiegel, Ulrike, Marklund, Stefan L, Walter, Ulrich, Meinertz, Thomas, Munzel, Thomas
author_sort warnholtz, ascan
container_issue 7
container_start_page 1356
container_title Journal of the American College of Cardiology
container_volume 40
description
doi_str_mv 10.1016/s0735-1097(02)02133-2
facet_avail Online, Free
finc_class_facet Medizin
format ElectronicArticle
format_de105 Article, E-Article
format_de14 Article, E-Article
format_de15 Article, E-Article
format_de520 Article, E-Article
format_de540 Article, E-Article
format_dech1 Article, E-Article
format_ded117 Article, E-Article
format_degla1 E-Article
format_del152 Buch
format_del189 Article, E-Article
format_dezi4 Article
format_dezwi2 Article, E-Article
format_finc Article, E-Article
format_nrw Article, E-Article
geogr_code not assigned
geogr_code_person not assigned
id ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAxNi9zMDczNS0xMDk3KDAyKTAyMTMzLTI
imprint Elsevier BV, 2002
imprint_str_mv Elsevier BV, 2002
institution DE-D275, DE-Bn3, DE-Brt1, DE-Zwi2, DE-D161, DE-Gla1, DE-Zi4, DE-15, DE-Pl11, DE-Rs1, DE-105, DE-14, DE-Ch1, DE-L229
issn 0735-1097
issn_str_mv 0735-1097
language English
last_indexed 2024-03-01T15:08:28.679Z
match_str warnholtz2002adverseeffectsofnitroglycerintreatmentonendothelialfunctionvascularnitrotyrosinelevelsandcgmpdependentproteinkinaseactivityinhyperlipidemicwatanaberabbits
mega_collection Elsevier BV (CrossRef)
physical 1356-1363
publishDate 2002
publishDateSort 2002
publisher Elsevier BV
record_format ai
recordtype ai
series Journal of the American College of Cardiology
source_id 49
spelling Warnholtz, Ascan Mollnau, Hanke Heitzer, Thomas Kontush, Anatol Möller-Bertram, Tobias Lavall, Dirk Giaid, Adel Beisiegel, Ulrike Marklund, Stefan L Walter, Ulrich Meinertz, Thomas Munzel, Thomas 0735-1097 Elsevier BV Cardiology and Cardiovascular Medicine http://dx.doi.org/10.1016/s0735-1097(02)02133-2 Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits Journal of the American College of Cardiology
spellingShingle Warnholtz, Ascan, Mollnau, Hanke, Heitzer, Thomas, Kontush, Anatol, Möller-Bertram, Tobias, Lavall, Dirk, Giaid, Adel, Beisiegel, Ulrike, Marklund, Stefan L, Walter, Ulrich, Meinertz, Thomas, Munzel, Thomas, Journal of the American College of Cardiology, Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits, Cardiology and Cardiovascular Medicine
title Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_full Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_fullStr Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_full_unstemmed Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_short Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
title_sort adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cgmp-dependent protein kinase activity in hyperlipidemic watanabe rabbits
title_unstemmed Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
topic Cardiology and Cardiovascular Medicine
url http://dx.doi.org/10.1016/s0735-1097(02)02133-2