Eintrag weiter verarbeiten
Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits
Gespeichert in:
Zeitschriftentitel: | Journal of the American College of Cardiology |
---|---|
Personen und Körperschaften: | , , , , , , , , , , , |
In: | Journal of the American College of Cardiology, 40, 2002, 7, S. 1356-1363 |
Format: | E-Article |
Sprache: | Englisch |
veröffentlicht: |
Elsevier BV
|
Schlagwörter: |
author_facet |
Warnholtz, Ascan Mollnau, Hanke Heitzer, Thomas Kontush, Anatol Möller-Bertram, Tobias Lavall, Dirk Giaid, Adel Beisiegel, Ulrike Marklund, Stefan L Walter, Ulrich Meinertz, Thomas Munzel, Thomas Warnholtz, Ascan Mollnau, Hanke Heitzer, Thomas Kontush, Anatol Möller-Bertram, Tobias Lavall, Dirk Giaid, Adel Beisiegel, Ulrike Marklund, Stefan L Walter, Ulrich Meinertz, Thomas Munzel, Thomas |
---|---|
author |
Warnholtz, Ascan Mollnau, Hanke Heitzer, Thomas Kontush, Anatol Möller-Bertram, Tobias Lavall, Dirk Giaid, Adel Beisiegel, Ulrike Marklund, Stefan L Walter, Ulrich Meinertz, Thomas Munzel, Thomas |
spellingShingle |
Warnholtz, Ascan Mollnau, Hanke Heitzer, Thomas Kontush, Anatol Möller-Bertram, Tobias Lavall, Dirk Giaid, Adel Beisiegel, Ulrike Marklund, Stefan L Walter, Ulrich Meinertz, Thomas Munzel, Thomas Journal of the American College of Cardiology Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits Cardiology and Cardiovascular Medicine |
author_sort |
warnholtz, ascan |
spelling |
Warnholtz, Ascan Mollnau, Hanke Heitzer, Thomas Kontush, Anatol Möller-Bertram, Tobias Lavall, Dirk Giaid, Adel Beisiegel, Ulrike Marklund, Stefan L Walter, Ulrich Meinertz, Thomas Munzel, Thomas 0735-1097 Elsevier BV Cardiology and Cardiovascular Medicine http://dx.doi.org/10.1016/s0735-1097(02)02133-2 Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits Journal of the American College of Cardiology |
doi_str_mv |
10.1016/s0735-1097(02)02133-2 |
facet_avail |
Online Free |
finc_class_facet |
Medizin |
format |
ElectronicArticle |
fullrecord |
blob:ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAxNi9zMDczNS0xMDk3KDAyKTAyMTMzLTI |
id |
ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAxNi9zMDczNS0xMDk3KDAyKTAyMTMzLTI |
institution |
DE-D275 DE-Bn3 DE-Brt1 DE-Zwi2 DE-D161 DE-Gla1 DE-Zi4 DE-15 DE-Pl11 DE-Rs1 DE-105 DE-14 DE-Ch1 DE-L229 |
imprint |
Elsevier BV, 2002 |
imprint_str_mv |
Elsevier BV, 2002 |
issn |
0735-1097 |
issn_str_mv |
0735-1097 |
language |
English |
mega_collection |
Elsevier BV (CrossRef) |
match_str |
warnholtz2002adverseeffectsofnitroglycerintreatmentonendothelialfunctionvascularnitrotyrosinelevelsandcgmpdependentproteinkinaseactivityinhyperlipidemicwatanaberabbits |
publishDateSort |
2002 |
publisher |
Elsevier BV |
recordtype |
ai |
record_format |
ai |
series |
Journal of the American College of Cardiology |
source_id |
49 |
title |
Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_unstemmed |
Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_full |
Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_fullStr |
Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_full_unstemmed |
Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_short |
Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_sort |
adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cgmp-dependent protein kinase activity in hyperlipidemic watanabe rabbits |
topic |
Cardiology and Cardiovascular Medicine |
url |
http://dx.doi.org/10.1016/s0735-1097(02)02133-2 |
publishDate |
2002 |
physical |
1356-1363 |
description |
|
container_issue |
7 |
container_start_page |
1356 |
container_title |
Journal of the American College of Cardiology |
container_volume |
40 |
format_de105 |
Article, E-Article |
format_de14 |
Article, E-Article |
format_de15 |
Article, E-Article |
format_de520 |
Article, E-Article |
format_de540 |
Article, E-Article |
format_dech1 |
Article, E-Article |
format_ded117 |
Article, E-Article |
format_degla1 |
E-Article |
format_del152 |
Buch |
format_del189 |
Article, E-Article |
format_dezi4 |
Article |
format_dezwi2 |
Article, E-Article |
format_finc |
Article, E-Article |
format_nrw |
Article, E-Article |
_version_ |
1792336969887383567 |
geogr_code |
not assigned |
last_indexed |
2024-03-01T15:08:28.679Z |
geogr_code_person |
not assigned |
openURL |
url_ver=Z39.88-2004&ctx_ver=Z39.88-2004&ctx_enc=info%3Aofi%2Fenc%3AUTF-8&rfr_id=info%3Asid%2Fvufind.svn.sourceforge.net%3Agenerator&rft.title=Adverse+effects+of+nitroglycerin+treatment+on+endothelial+function%2C+vascular+nitrotyrosine+levels+and+cGMP-dependent+protein+kinase+activity+in+hyperlipidemic+Watanabe+rabbits&rft.date=2002-10-01&genre=article&issn=0735-1097&volume=40&issue=7&spage=1356&epage=1363&pages=1356-1363&jtitle=Journal+of+the+American+College+of+Cardiology&atitle=Adverse+effects+of+nitroglycerin+treatment+on+endothelial+function%2C+vascular+nitrotyrosine+levels+and+cGMP-dependent+protein+kinase+activity+in+hyperlipidemic+Watanabe+rabbits&aulast=Munzel&aufirst=Thomas&rft_id=info%3Adoi%2F10.1016%2Fs0735-1097%2802%2902133-2&rft.language%5B0%5D=eng |
SOLR | |
_version_ | 1792336969887383567 |
author | Warnholtz, Ascan, Mollnau, Hanke, Heitzer, Thomas, Kontush, Anatol, Möller-Bertram, Tobias, Lavall, Dirk, Giaid, Adel, Beisiegel, Ulrike, Marklund, Stefan L, Walter, Ulrich, Meinertz, Thomas, Munzel, Thomas |
author_facet | Warnholtz, Ascan, Mollnau, Hanke, Heitzer, Thomas, Kontush, Anatol, Möller-Bertram, Tobias, Lavall, Dirk, Giaid, Adel, Beisiegel, Ulrike, Marklund, Stefan L, Walter, Ulrich, Meinertz, Thomas, Munzel, Thomas, Warnholtz, Ascan, Mollnau, Hanke, Heitzer, Thomas, Kontush, Anatol, Möller-Bertram, Tobias, Lavall, Dirk, Giaid, Adel, Beisiegel, Ulrike, Marklund, Stefan L, Walter, Ulrich, Meinertz, Thomas, Munzel, Thomas |
author_sort | warnholtz, ascan |
container_issue | 7 |
container_start_page | 1356 |
container_title | Journal of the American College of Cardiology |
container_volume | 40 |
description | |
doi_str_mv | 10.1016/s0735-1097(02)02133-2 |
facet_avail | Online, Free |
finc_class_facet | Medizin |
format | ElectronicArticle |
format_de105 | Article, E-Article |
format_de14 | Article, E-Article |
format_de15 | Article, E-Article |
format_de520 | Article, E-Article |
format_de540 | Article, E-Article |
format_dech1 | Article, E-Article |
format_ded117 | Article, E-Article |
format_degla1 | E-Article |
format_del152 | Buch |
format_del189 | Article, E-Article |
format_dezi4 | Article |
format_dezwi2 | Article, E-Article |
format_finc | Article, E-Article |
format_nrw | Article, E-Article |
geogr_code | not assigned |
geogr_code_person | not assigned |
id | ai-49-aHR0cDovL2R4LmRvaS5vcmcvMTAuMTAxNi9zMDczNS0xMDk3KDAyKTAyMTMzLTI |
imprint | Elsevier BV, 2002 |
imprint_str_mv | Elsevier BV, 2002 |
institution | DE-D275, DE-Bn3, DE-Brt1, DE-Zwi2, DE-D161, DE-Gla1, DE-Zi4, DE-15, DE-Pl11, DE-Rs1, DE-105, DE-14, DE-Ch1, DE-L229 |
issn | 0735-1097 |
issn_str_mv | 0735-1097 |
language | English |
last_indexed | 2024-03-01T15:08:28.679Z |
match_str | warnholtz2002adverseeffectsofnitroglycerintreatmentonendothelialfunctionvascularnitrotyrosinelevelsandcgmpdependentproteinkinaseactivityinhyperlipidemicwatanaberabbits |
mega_collection | Elsevier BV (CrossRef) |
physical | 1356-1363 |
publishDate | 2002 |
publishDateSort | 2002 |
publisher | Elsevier BV |
record_format | ai |
recordtype | ai |
series | Journal of the American College of Cardiology |
source_id | 49 |
spelling | Warnholtz, Ascan Mollnau, Hanke Heitzer, Thomas Kontush, Anatol Möller-Bertram, Tobias Lavall, Dirk Giaid, Adel Beisiegel, Ulrike Marklund, Stefan L Walter, Ulrich Meinertz, Thomas Munzel, Thomas 0735-1097 Elsevier BV Cardiology and Cardiovascular Medicine http://dx.doi.org/10.1016/s0735-1097(02)02133-2 Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits Journal of the American College of Cardiology |
spellingShingle | Warnholtz, Ascan, Mollnau, Hanke, Heitzer, Thomas, Kontush, Anatol, Möller-Bertram, Tobias, Lavall, Dirk, Giaid, Adel, Beisiegel, Ulrike, Marklund, Stefan L, Walter, Ulrich, Meinertz, Thomas, Munzel, Thomas, Journal of the American College of Cardiology, Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits, Cardiology and Cardiovascular Medicine |
title | Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_full | Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_fullStr | Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_full_unstemmed | Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_short | Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
title_sort | adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cgmp-dependent protein kinase activity in hyperlipidemic watanabe rabbits |
title_unstemmed | Adverse effects of nitroglycerin treatment on endothelial function, vascular nitrotyrosine levels and cGMP-dependent protein kinase activity in hyperlipidemic Watanabe rabbits |
topic | Cardiology and Cardiovascular Medicine |
url | http://dx.doi.org/10.1016/s0735-1097(02)02133-2 |